PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.6G188300.1.p
Common NamePRUPE_ppa019923mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family MYB
Protein Properties Length: 344aa    MW: 38129.7 Da    PI: 6.1722
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.6G188300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding568.9e-181461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+eEd++l +++++ G g+W++ ++  g++R++k+c++rw +yl
  Prupe.6G188300.1.p 14 KGPWTPEEDQKLMNYIQKNGHGSWRALPKLAGLNRCGKSCRLRWTNYL 61
                        79********************************************97 PP

2Myb_DNA-binding55.91e-1767112148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rg++++eE++ +++++  lG++ W++Ia++++ gRt++++k++w+++l
  Prupe.6G188300.1.p  67 RGKFSQEEEQTILNLHSILGNK-WSAIASHLP-GRTDNEIKNFWNTHL 112
                         89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.5E-26564IPR009057Homeodomain-like
PROSITE profilePS5129417.854961IPR017930Myb domain
SuperFamilySSF466897.26E-3211108IPR009057Homeodomain-like
SMARTSM007175.8E-141363IPR001005SANT/Myb domain
PfamPF002496.5E-171461IPR001005SANT/Myb domain
CDDcd001674.27E-111661No hitNo description
PROSITE profilePS5129426.74462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.4E-2865117IPR009057Homeodomain-like
SMARTSM007173.6E-1766114IPR001005SANT/Myb domain
PfamPF002491.8E-1667112IPR001005SANT/Myb domain
CDDcd001676.75E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MGRSPCCDES GLKKGPWTPE EDQKLMNYIQ KNGHGSWRAL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SQEEEQTILN LHSILGNKWS AIASHLPGRT DNEIKNFWNT HLKKKLIQMG  120
FDPMTHRPRT DIFSSLPHLL ALVNLKELLD HGGHTSWDEQ AVRLQAEAAQ MARLQYLQCL  180
LQPPPANNSF GAGSPSNLND ITDMETINLL SSLCSYQLDQ NPPQYPGANF EPVQDHNSIP  240
FSHLPDLQTY QTPSLNNNKD MVNQAEDQFA VVLSQGQNSP NNPWNIPSSS NTTPSPTSMA  300
PPVAETSISN TMGDACSTSS FGGVANSAWS ELLLEDSFFN EIA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-30121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00180DAPTransfer from AT1G34670Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007207610.10.0hypothetical protein PRUPE_ppa019923mg
TrEMBLM5W5260.0M5W526_PRUPE; Uncharacterized protein
STRINGPOPTR_0005s07590.11e-149(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.11e-106myb domain protein 93